PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn062481
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family MYB_related
Protein Properties Length: 238aa    MW: 26277.9 Da    PI: 9.8205
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn062481genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.14.6e-1489133347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +W+++E+ l++ + ++lG+g+W+ Ia+++   Rt+ q+ s+ qky
       Achn062481  89 PWSEDEHRLFLAGLEKLGKGDWRGIAKKFVPSRTPTQVASHAQKY 133
                      8*****************************9*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.07782138IPR017930Myb domain
SuperFamilySSF466899.72E-1784138IPR009057Homeodomain-like
TIGRFAMsTIGR015575.9E-1785136IPR006447Myb domain, plants
SMARTSM007179.2E-1286136IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.9E-1286132IPR009057Homeodomain-like
CDDcd001672.05E-1189134No hitNo description
PfamPF002499.4E-1289133IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MVKESARKCS HCGHNGHNTR TCNGKACMKL FGVTIVAQRE DESMRKSKST GDLIACNGEH  60
SALDAGYLSD GLVHSRRAKE AHERKKGVPW SEDEHRLFLA GLEKLGKGDW RGIAKKFVPS  120
RTPTQVASHA QKYFIRLAST SKKKRRSSLF DMSFAEPEIP PSPPQEPLDK PTETPQQVGG  180
KVVPTVSFVP VMNFPNHGYF YMPKGHANYA TCAPYMSQPP YSFLPQPFPH EPSQAGP*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1141145KKKRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010662238.12e-83PREDICTED: transcription factor MYB1R1-like isoform X2
TrEMBLM5X2816e-77M5X281_PRUPE; Uncharacterized protein
STRINGPGSC0003DMT4000556165e-63(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA117831823
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61620.13e-63MYB_related family protein